PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0006100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 471aa    MW: 50809.9 Da    PI: 6.3244
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0006100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4032.9e-123534651374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..........sseelaalkl 83 
                     l++lLl+cA+ v++gdle a+a+L+++  l aspdgd+mqR+aa ft ALa+rl+r s++++++a++++++                 +l a++ 
  Spipo6G0006100  53 LIHLLLNCANYVAAGDLEHANACLEHIALLgASPDGDTMQRIAALFTDALARRLLRsSWPGIFRAITTTSSGGGGggattaapspAPAALLARRH 147
                     689*****************************************************9********998877644444444556666677777799 PP

            GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                     f++++P+lk+s+++aNqaIlea+ege+ vH iD+ +  +  W+aLlqaL+ Rpeg+p+lRiTgv++    ++e le +++rL++ Ae+l+vpf+f
  Spipo6G0006100 148 FFDLCPFLKLSYVIANQAILEAMEGEHVVHLIDLHAADPSPWIALLQALSRRPEGAPHLRITGVHD----QREVLELVASRLSDEAEKLDVPFQF 238
                     ******************************************************************....9************************ PP

            GRAS 179 nvlvakrledlele.eLrvkpgEalaVnlvlqlhrll..........................desvsleserdevLklvkslsPkvvvvveqea 246
                     n+ v+++ledl+ e +Lrvk+gEa+aV+++lqlhrll                          + + s + + d++L ++++l Pk++vv+eqe+
  Spipo6G0006100 239 NA-VVSKLEDLDAErSLRVKTGEAVAVCSILQLHRLLapdsyrkpsspsrcsvlrsgdsgvssAPPPSCSTRMDAFLAALWGLAPKIMVVAEQES 332
                     **.7999***987638********************************************9987777778899********************** PP

            GRAS 247 dhnsesFlerflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                     dhn++s++erf+eal+yy+alfd+le+ ++++   eer+ vE  l+g+e +++va+egaerrerhe+l +W +r+e+aGF  vpls++a  qa++
  Spipo6G0006100 333 DHNGGSLVERFTEALNYYAALFDCLESAAAAAGrgEERARVESTLFGEEMRDIVAAEGAERRERHERLDRWLRRMESAGFLRVPLSYYALLQARR 427
                     *************************7765555458************************************************************ PP

            GRAS 340 llrkvk..sdgyrveee.sgslvlgWkdrpLvsvSaWr 374
                     ll++ +    gy v ee  g+  l+W+dr+L+svSaWr
  Spipo6G0006100 428 LLQQGYggCGGYGVREEaGGCHALCWQDRALFSVSAWR 465
                     **997766667***988255566**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.66827442IPR005202Transcription factor GRAS
PfamPF035141.0E-12053465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MVGMAVLDEG SSVASSPLQF LSLMSISRTA LAAGGGSPVV AQEMKSDERG IFLIHLLLNC  60
ANYVAAGDLE HANACLEHIA LLGASPDGDT MQRIAALFTD ALARRLLRSS WPGIFRAITT  120
TSSGGGGGGA TTAAPSPAPA ALLARRHFFD LCPFLKLSYV IANQAILEAM EGEHVVHLID  180
LHAADPSPWI ALLQALSRRP EGAPHLRITG VHDQREVLEL VASRLSDEAE KLDVPFQFNA  240
VVSKLEDLDA ERSLRVKTGE AVAVCSILQL HRLLAPDSYR KPSSPSRCSV LRSGDSGVSS  300
APPPSCSTRM DAFLAALWGL APKIMVVAEQ ESDHNGGSLV ERFTEALNYY AALFDCLESA  360
AAAAGRGEER ARVESTLFGE EMRDIVAAEG AERRERHERL DRWLRRMESA GFLRVPLSYY  420
ALLQARRLLQ QGYGGCGGYG VREEAGGCHA LCWQDRALFS VSAWRCRRFD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-43534654375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273289.11e-179PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-169SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A0J8CRG61e-173A0A0J8CRG6_BETVU; Uncharacterized protein
STRINGGSMUA_Achr8P09690_0011e-172(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-136scarecrow-like 3